Assume a protein is composed of 120 amino acid residues and that each amino acid can have three possible orientations. How many total possible orientations are there for the protein? Express the number of possible orientations to three significant figures. 15| ΑΣΦ xa Xb b 1.73 106 ● √x x x
Q: to use the pH simulator to answer the question: . Select the Macro setting on the simulator…
A: Go to the pH simulator homepageOpt for the "Macro" mode on the simulator.Find the green pH meter and…
Q: A hypothetical protein has a molar mass of 23,300 Da. Assume that the average molar mass of an amino…
A: Amino acids are organic compounds that combine to form proteins; thus, they are known as protein…
Q: The figure shown here is a Ramachandran plot. The plausible secondary structure that can be found in…
A: The Ramachandran plot is used to depict the statistical distribution of the combinations of the two…
Q: had a response from a peer and this is what they said: You mentioned that aliphatic amino acids…
A: As per the central dogma of molecular biology, DNA contains the code that is necessary for the…
Q: Part C If, in addition to the constraints on glucose concentration listed previously, we have in the…
A: Pi + Glucose -> Glucose-6-Phosphate + H2OFor the above reaction, ΔG°’ = + 13.8 kJ/mol and…
Q: In the absence of an enzyme, a reaction has a Keq = 10¹5. i. Is AGO for the reaction + or -? ii.…
A: In a general reaction such as:aA + bB ⇌ cC + dDAt equilibrium (steady state), the concentration of…
Q: You analyze a protein of 100 kDa using SDS-PAGE in the absence and presence of �-mercaptoethanol…
A: Multisubunit proteins are composed of more than 1 polypeptide chain.SDS (sodium dodecyl sulfate)…
Q: Show the calculation for the preparation of 0.01%, 0.001%, 0.0001%, 0.00001% standard DNA solutions…
A: A liquid combination containing DNA molecules is called a DNA solution. It is frequently employed in…
Q: In the peptide shown below, a covalent bond that could rotate to form secondary structure is…
A: Two types of secondary structures are abundant in protein: alpha helix and beta sheets. The alpha…
Q: The equilibrium constant of a system, K, can be related to the standard free energy change, AG,…
A: Details
Q: Based on the chemical structure shown above, fluticasone likely acts by binding to Receptor Tyrosine…
A: Allergies are defined as the immune response generated by the immune system (defense system) of the…
Q: Which statement about the glycoprotein shown below is true? OH CH₂OH OH HN HN-C O CH3 H₂ Protein CH…
A: Chemically, carbohydrates are polyhydroxy aldehydes or ketones. Monosaccharides are single unit…
Q: Enzymes increase the rate of biochemical reactions by which process? A) donating electrons to…
A: Enzymes are biological molecules that act as catalysts in living organisms. They speed up…
Q: Which of the following statements is TRUE? Urea disrupts primary protein structure Trace amounts of…
A: Beta-mercaptoethanol (BME) is a chemical compound commonly used in biochemistry and molecular…
Q: (a) Using the lecture entitled “On the Origin of life” by Jack Szostak. In one paragraph, summarize…
A: In his lecture titled "On the Origin of Life," Jack Szostak delves into the concept of an "RNA…
Q: increase in AMP Increases glycolytic activity glucagon secretion feeding insulin secretion increase…
A: A metabolic process called glucose synthesis allows the body to produce glucose from…
Q: What are the differences in atp formation in glycolysis vs oxidative met
A: ATP (adenosine triphosphate) is a critical molecule that stores and releases energy for cellular…
Q: Which of the following statements are true about the relationships of [S], KM, and Vmax? (Choose…
A: For a one-substrate enzyme catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: Gamma turns are divided into two classes based on the phi and psi rotational bond angles of the…
A: An illustration of the permitted and forbidden areas of the phi and psi dihedral angles in the…
Q: 2. NAD is synthesized from the vitamin niacin. The daily dietary intake of niacin recommended for…
A: NAD' is synthesized from the vitamin niacin. The daily dietary intake of niacin recommended for…
Q: 13. What is the main function of the carnitine shuttle system? a. To aid in the assembly of…
A: Carnitine shuttle system is a special mechanism that consists of two transport proteins called…
Q: Each of the reactions is catalyzed by an enzyme. For each reaction, classify the enzyme according to…
A: Most of the enzymes are divided into six major classes. They are1. Oxidoreductases2. Transferases3.…
Q: The hydrolysis of pyrophosphate to orthophosphate drives biosynthetic reactions such as DNA…
A: Enzymes are proteinaceous entities involved in chemical reactions contributing to the precedence of…
Q: Two possible point mutations are the substitution of lysine for leucine or the substitution of…
A: Amino acid mutations refer to changes in the DNA sequence that result in alterations to the sequence…
Q: membrane potential of a neuron drops to -55mV and sodium ions start to flow from outside to inside…
A: This question can be calculated by Nernst equation. This equation provides the relationship between…
Q: Decide whether each of the following statements is true about ornithine carbamoyltransferase. It's a…
A: Ornithine carbamoyltransferase is an enzyme is important in the urea cycle. Urea cycle is a…
Q: How do antibiotic-rich environments like hospitals speed up the rate at which superbugs increase…
A: It is the condition when bacteria evolves mechanics to make the antibiotics used against them as…
Q: Hydrogen bonds are noncovalent interactions between a hydrogen atom with a partial positive charge,…
A: Every hydrogen bond is composed of a hydrogen bond donor and a hydrogen bond acceptor.The hydrogen…
Q: hy do we generate ketones when we have low CHO levels
A: Acetyl co enzyme A is formed in the liver during oxidation of fatty acids, may either enter the…
Q: Consider the hypothetical serine protease, which shows the specificity pockets. The S₁ pocket has a…
A: Enzymes are biological catalysts that increasethe rate of biochemical reactions.Most enzymes are…
Q: [2] Calculate the pH of the arginine solution after the addition of Oml, 5ml of 0.1M NaOH and…
A: A method employed in laboratories for calculating an amino acid's pKa values and isoelectric point…
Q: Beta sheets shown in the figure below are: "" Parallel Not enough information One strand is parallel…
A: Here it is clearly mentioned that what its helical secondary structure.
Q: Consider the sterilization of a sodium gluconate production medium in the holding section of a…
A: Answer :- Sterilization is a critical process in various industries, including food and…
Q: Transport of histidine into a bacterial cell was measured at several different histidine…
A: The kinetics of transport of a molecule via a carrier protein and a protein channel differ from each…
Q: Which of the following is/are true regarding SDS-PAGE (there may be more than one correct answer,…
A: SDS-PAGE is the abbreviation for Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis.It is a…
Q: 10) Explain how the Km and [VO] of a reaction between a fixed amount of catalase and a gradually…
A: An allosteric inhibitor doesn't competes with the substrate for binding at active site. It binds to…
Q: Mary Jo prepared a series of diluted samples by taking 1 mL of sample and adding it to 4 mLs of…
A: Here, Mary Jo is undertaking serial dilution (i.e. a series of consecutive dilutions) comprising of…
Q: In order for ATP to effectively deliver energy to an enzyme, the following needs to be the case: a.…
A: Endergonic reactions are reactions that cannot be driven forward without an input of energy.…
Q: Double-reciprocal, or Lineweaver-Burk, plots can reveal the type of enzyme inhibition exhibited by…
A: Enzymes are biological catalysts that increase the rate of biochemical reactions.In an enzyme…
Q: This question has been posted previously with parts A B and C already answered. Please focus on only…
A: Amino acids classified as hydrophobic have side chains (R groups) that have a propensity to resist…
Q: two of the three biopolymers and explain why these biopolymers are not good options for…
A: Polymers are long-chain molecules while biomolecules are molecules produced by biological entities,…
Q: Which of the following would not increase efficiency of transfer of oxygen from hemoglobin to…
A: Haemoglobin is a transport protein that helps in carrying of respiratory gases like oxygen and…
Q: Which one of these molecules would not be in a membrane? HC-0 НО HC-0 HC-0 image A D Galactose is a…
A: The most prevalent lipid molecules found in plasma membranes, commonly referred to as cell…
Q: With the disruption of PDHC activity, TCA cycle is also effected. which of the following…
A: A grave medical illness called sepsis is marked by an excessive immunological reaction to an…
Q: A tetrapeptide was analyzed with carboxypeptidase, the results from the analysis are found in the…
A: There are four classes of biological macromolecules- proteins, nucleic acids, lipoproteins and…
Q: Myoglobin has a oxygen. it 111111 Higher; transports O Lower; transports affinity for oxygen…
A: Myoglobin and hemoglobin are both proteins involved in oxygen transport, but they have different…
Q: the DNA segment 5′-ATGAGGCATGAGACG-3′(coding strand) 3′-TACTCCGTACTCTGC-5′ (template strand) •…
A: Replication is the process in which template strand of DNA is copied into complementary strand of…
Q: The Michaelis-Menten equation is often used to describe the kinetic characteristics of an…
A: Vmax is defined as the maximum reaction velocity at which all enzymes become saturated with…
Q: main binding pocket inside the GLP-1 receptor and the critical residues found in GLP-1 particularly…
A: GLP-1 receptor is glucagon-like peptide-1 receptor. It is a G-protein-coupled receptor that is…
Q: 1. (a) By binding one L-tryptophan molecule/monomer, the trp repressor binds to DNA to sup- press…
A: An atom's or molecule's electrostatic charge, which can be either positive or negative depending on…
Trending now
This is a popular solution!
Step by step
Solved in 3 steps
- Part B Assume a protein is composed of 120 amino acid residues and that each amino acid can have three possible orientations. How many total possible orientations are there for the protein? Express the number of possible orientations to three significant figures. —| ΑΣΦ 1.797 • 1057 Each possible orientation of an amino acid is due to rotation about a bond. Since there are two terminal amino acids, there will be one fewer peptide bond compared to the number of amino acids. No credit lost. Try again. Submit ? Previous Answers Request Answer orientationsA researcher isolates a new protein and finds that it contains 0.755% serine by weight upon amino acid analysis. The molecular mass of serine is 105 g.mol-¹. What is the minimum molecular mass for the protein assuming only one Ser residue per protein molecule? mmin = The researcher estimates the molecular mass of the protein using gel electrophoresis. From this estimated molecular mass, the researcher concludes the protein contains 3 Ser residues. What is the estimated molecular mass of the protein as shown by gel electrophoresis? g.mol-¹ mest = g.mol-1Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSA
- Provide the number of polypeptide chains present andthe number of amino acid residues in each chain. for https://www.rcsb.org/structure/6j20 Provide the molecular weight of the protein orprotein complex and the total number of atoms. (All of this information can be found in the PDBpage.) Create a figure (available in the PDB page) that shows the topology of your protein, i.e.the secondary structures adopted by different regions of the protein (alpha helix, beta strand).Make sure to also provide a figure legend that helps interpret the figure and appropriate figurecaption that briefly explains the figure.The simple average molecular weight of the 20 common amino acids is 138 , but most biochemists use 110 when estimating the number of amino acids in a protein of known molecular weight. Why do you suppose this is? (Hint: There are two contributing factors to the answer. One of them will be apparent from a brief consideration of the amino acid compositions of common proteins. See, for example, Figure -Bellow)Proteins are composed of both polar (hydrophilic) and nonpolar (hydrophobic) amino acids. Assume you are starting with fresh homogenized/pasteurized cow's milk. A major protein in the milk is a whey protein known as alpha-lactalbumin (in a tertiary structure). If this protein is denatured (for example by the introduction of heat, acid, or other means), discuss how and why scientifically it could end up becoming an effective emulsifier in a product containing olive oil and red wine vinegar.
- Look at the amino acid composition of a protein given in the table and click on the area in the 2D gel electrophoresis where you may expect the corresponding band. Amino acid composition M N P 7 3 11 A D E F G K R S V W Y ТОTAL: 16 2 12 14 4 1 3 7 2 11 11 10 1 164 Download Image. pH7 pH 9 pH3 200,000 116,250 97,400 66,200 45,000 31,000 21,500 14,400 ||| | |||Imagine the main chain of a protein bends back on itself, so that two amino acid residues R, and R, come close to each other. In the table below are four possibilities for what R, and R, might be. In each case, decide whether a specific interaction could form between the residues. If a specific interaction could form, give the name of the interaction. R1 R2 specific interaction? name of specific interaction O yes serine tyrosine O no О yes valine threonine O no O yes threonine glutamine O no О yes cysteine cysteine noa) Draw amino acid (L- Cysteine) and determine the net chagre at each pH (1-3-7-10-13-) b) Calculate the pl for amino acid (Cysteine) 3. This question requires you to use an amino acid with an ionizable R group. Use the Amino Acids with lonizable R Groups chart to determine which amino acid you will be using. For student number 000123456; 2-6 and using the chart for Question 3 this corresponds to Glutamic Acid. Amino Acid 3=Z= pH 1 Draw the structure of L-amino acid 3 at the pH's in the table below and determine the net charge at each pH and the gl for amino acid 3. 10 Name of amino acid 3: 13 Cysteine Structure Net Charge
- In the molecule of oligomeric protein there are 19 lysine residues. 12 of them may be easily acetylated with anhydrides of dicarbon acids (it react with NH2-groups). The acetylation of extra two residues of lysine will dissociate the protein to the subunits. The rest 5 lysine residues may be modified only after denaturation of the protein. Suggest, how many lysine residues are: a) on a surface of protein globule; b) inside globule: c) in a site which is responsible for the contact within subunitsExperimental results describing a protein's amino acid composition are useful for estimating the molecular weight (MW) of the entire protein. A quantitative amino acid analysis reveals that bovine cytochrome c contains 1% tryptophan (M, 204) by weight. Calculate the approximate molecular weight of bovine cytochrome c if there is 1 tryptophan residue. Please enter your answer with three significant figures. approximate bovine cytochrome c MW: number of threonine residues: 19.4 20.4 x10³ Bovine chymotrypsinogen has a molecular weight of 25.6 kDa. Amino acid analysis shows that this enzyme is 9% threonine (M, 119). Calculate how many threonine residues are present in a molecule of bovine chymotrypsinogen. Round your answer to the nearest whole number. Incorrect Incorrect DaThe bacterially produced antibiotic gramicidin A forms channels in cell membranes that allow the free diff usion of Na+ and K+ ions, thereby killing the cell. This peptide consists of a sequence of Dand L-amino acids. The sequence of a segment of fi ve amino acids in gramicidin A is R-Gly-L-Ala-D-Leu-L-Ala-D-Val-R′. Complete the Fischer projection below by adding the correct group to each vertical bond.