Pseudomonas aeruginosa Log (CFU/ml) 3.9 3.9 4.2 4.5 Time (hr) 0 15 30 45 60 75 90 105 120 135 150 165 180 195 210 CFU/ml Time (hr) 8E-3 SE+3 16000 32000 64000 128000 256000 512000 4.8 5.1 5.4 5.7 1024000 6 2048000 6.3 4096000 6.6 8192000 6.9 16384000 7.2 16768000 7.22 16360000 7.21 Pseudomonas fluorescens Log (CFU/ml) CFU/ml 9.00E-03 9.01E-03 18000 36000 72000 144000 288000 576000 1152000 2304000 0 17 34 51 68 85 102 119 136 153 170 4608000 187 9216000 204 18432000 221 18520300 238 18503200
Q: Which of the following is a derived trait of chordates?
A: Chordata is belong to the kingdom Animalia and include all vertebrates.
Q: How the sodium potassium pump works in primary active transport? The renin angiotensin aldosterone…
A: Active transport in cellular biology refers to the movement of molecules or ions across a cell…
Q: below using the same level of detail as provided in the image below. Hint: Remember that DNA bases p…
A: (a) A nucleotide is made up of a sugar molecule (ribose in the case of RNA and deoxyribose in the…
Q: 1 A) . If green is dominant wt (Y) and yellow is a recessive mutant condition (y), depict a Yy…
A: Introduction : A square diagram known as the Punnett square is used to predict the genotypes of a…
Q: Which receptors are the main source of inhibition in the brain? To what ions are they permeable?…
A: Introduction :- Shunting inhibition is a type of inhibitory synaptic transmission that occurs in the…
Q: Why might alcohol dehydrogenase metabolize ethylene glycol and how could you use ethanol to treat…
A: Ethylene glycol poisoning occurs when a person consumes or inhales the toxic chemical ethylene…
Q: What lipids can you consume for breakfast? What lipids can you consume for lunch? What liquids can…
A: Introduction :- Lipids are a group of naturally occurring molecules that include fats, oils, waxes,…
Q: Production of epinephrine and norepinephrine by the adrenal medulla is controlled by the___?…
A: The production of hormones such as epinephrine and norepinephrine by the adrenal medulla is an…
Q: 6. A population has a homozygous recessive genotype (aa) of 36%. Calculate the following (show your…
A: Introduction : In the absence of other evolutionary factors like gene migration or gene flow,…
Q: MODELING MEIOSIS: Crossing Over Draw only: 1 pair of chromosomes 2 genes (on each chromosome)s, 2…
A: Introduction :- Crossing over is a process that occurs during meiosis, a type of cell division that…
Q: What is the difference between the light microscope, scanning electron microscope and transmission…
A: Note: According to bartleby guidelines only first question is to be answered. So please upload…
Q: F. Test the hypothesis 4 Chemistry of Life 4. How many valence electrons are present in the…
A: Introduction - Valence Electrons outermost electrons - the "s" and "p" electrons in the last energy…
Q: Question 5 of 26 Sexual reproduction provides an advantage to organisms because it increases the…
A: In sexual reproduction, offspring are produced by the fusion of two haploid cells, each carrying…
Q: You are confronted with two soft, squishy creatures that, on first glance, appear to be very…
A: We are given a situation in which we identified two specimens. One was identified as slug and…
Q: A class of students mated fruit flies to study the inheritance of traits. The crosses and their…
A: Introduction : A single cell divides twice to form four cells during the meiosis process. The…
Q: Which of the following organelles are most likely to be able to divide and reproduce much like a…
A: What are cellular organules? Eukaryotic cells contain different cellular organelles that cause…
Q: “Animal personality” has been defined as consistent differences between individuals that persist…
A: The given information about time taken by individual anemones to reopen the tentacles on two…
Q: What is the most abundant dissolved gas in the blood? Group of answer choices Nitrogen Oxygen Carbon…
A: There are several gases present in blood, including: Oxygen (O2) - The most abundant gas in the…
Q: How are DNA molecules visualized in a gel after electrophoresis? Why do DNA molecules migrate toward…
A: Gel electrophoresis is a technique used for the separation and isolation of the various fragments of…
Q: Brown adipose tissue... A. Has a rich blood supply and many mitochondria B. Is used for heat…
A: Adipose tissue is a kind of connective tissue which stores fat in subcutaneous layer of the skin…
Q: Why does Complex II use FAD instead of NAD+ as its electron acceptor?
A: Cellular respiration is a metabolic phenomenon in which glucose molecule is degraded and results in…
Q: In a cloning experiment a fragment of DNA is ligated with a vector such as a plasmid. Following the…
A: The transformation step is an important part of cloning experiments because it helps us get the…
Q: Are prion and virons viruses? Give examples of human or animal diseases caused by prions and what…
A: Introduction Viruses are submicroscopic infectious agents that consist of genetic material (DNA or…
Q: All of the following are true for both anaerobic respiration and fermentation except: Lack the…
A: Introduction Cellular respiration is a metabolic process that occurs in the cells of living…
Q: identify the hormones produced by the adrenal cortex and adrenal medulla and summarize their target…
A: The small, triangular-shaped adrenal glands are found above each kidney. They are an integral…
Q: How many net ATP can be generated from 2 triglycerides, 5 free fatty acids, and 11 glucose molecules…
A: ATP (Adenosine Triphosphate) is the primary energy currency of cells and is used to power cellular…
Q: Is this the correct phenotype frequency? Environment: Clean Forest Moths Released 810 190 1000…
A: If the two alleles are denoted by (D) and (d), then, p = frequency of allele D in population. =…
Q: How many different enzymes are used to repair a depurinated base?
A: Enzymes are proteins that act as biological catalysts, meaning they speed up chemical reactions…
Q: Which of the following is(are) correct about the property of water? ► O Water dissolves foods…
A: INTRODUCTION Water is a molecule made of two hydrogen atoms bonded to an oxygen atom. It is one of…
Q: Place the following components in order from least to most complex (atom, proton, starch, glucose,…
A: Components that are least complex have lesser constituents as compared to most complex constituents.…
Q: How does a selectively permeable membrane help maintain homeostasis? If a mrna has a codon of cua…
A: Introduction :- tRNA, or transfer RNA, is a type of RNA molecule that plays a crucial role in the…
Q: A mutation in a gene often results in a reduction of the product of that gene. The term for this…
A: Introduction A mutation is a permanent alteration in the DNA sequence that makes up a gene.…
Q: Why should an absorbent container not be used in collecting fecal material?
A: Introduction :- Fecal matter, also known as stool or feces, is the solid or semisolid waste material…
Q: One result of X-linkage is a crisscross pattern of inheritance in which sons express recessive genes…
A: . X-linked genes are genes located on the X chromosome, which is one of the two sex chromosomes in…
Q: Try to complete this matching section The posterior body region of an insect, typically containing…
A: Introduction Insects are a class of animals in the phylum Arthropoda, characterized by having three…
Q: Based on strange arrangements of bones, some archaeologists believed that the Neanderthals had a…
A: Introduction Primate evolution refers to the process of change in the anatomy, physiology,…
Q: Regarding the Global Reporting Initiative (GRI) GRI-G4 Guidelines, what are the indicators related…
A: Introduction Health is a state of complete physical, mental, and social well-being and not merely…
Q: Briefly describe the reasons that renal diseases result in anaemia.
A: Introduction :- Anemia is a condition in which the body does not have enough red blood cells or the…
Q: A. How long will the coding region of the processed mRNA transcript be? (Remember that stop codons…
A: A. In an mRNA exons refer to the coding region while introns refer to the non-coding regions. During…
Q: macroscopically describe the appearance of a normal and abnormal stool
A: Stool, or feces as they are commonly known, has many different properties depending on the…
Q: Describe the significance of clinical laboratories being regulated and registered in the…
A: Introduction :- Clinical laboratories are facilities that perform medical tests on specimens taken…
Q: When comparing individuals of a population, a scientists finds a trait (A) that is shared by most…
A: Introduction Natural selection is a process by which populations of organisms change over time…
Q: Q 1. To make 500 mL of 1x Buffer, measure ANSWER mL of 10x stock and add ANSWER mL water to make the…
A: Introduction Dilution is the process of reducing the concentration of a solute in a solution by…
Q: Dolphins have 44 chromosomes. How many chromatids are there in the following cells and/or cell…
A: Q. Ans:- Explanation:- Chromatid is the DNA strand of the chromosome, during the S phase of the cell…
Q: What process best characterizes Ca2+ movement from the cytosol (low Ca2+ concentration) into the…
A: The plasma membrane or cell membrane acts as a barrier that separates the internal and external…
Q: What is the summary of this paragraph?
A: A crucial component of human cognition and behavior is cognitive and social flexibility. Cognitive…
Q: Which level of protein structure results entirely from hydrogen bonding? secondary primary O…
A: Introduction :- A protein is a large, complex molecule made up of chains of smaller molecules called…
Q: a) b) X³ Xb X²Y A Figure 1 Name the pattern of inheritance in figure 1. Briefly explain the…
A: in the given figure, circle represents females while square represents the males. Also affected…
Q: An isomer is a molecule with the same formula, but different arrangement of atoms. True False
A: Introduction A molecule is a group of two or more atoms that are chemically bonded together to form…
Q: Which one of the following traits is not shared by most model species? A. High fecundity B. Short…
A: Introduction Development refers to the process by which a living organism grows and changes over…
Step by step
Solved in 2 steps
- EcoRI 4359 Aatll - Zral 4284 Bei 4209 BsrBl 4205 Clal - BspDI 23 Hindill 29 EcoRV 185 Bmtl - Nhel 229 Sspl 4168 Earl 4155 Acul 4048 Xmnl 3961 Hincll 3905 Scal 3844 BamH 375 Sgrl 409 Banll 471 Banll 485 Вы 3787 Bsl 3759 Bgl 528 Sphl 562 EcoNI 622 Sal - Acct - Hincll 651 Pvul 3733 Pstl 3607 Bartl 3602 Pshl 712 Asel 3537 Eagl 909 Bell 949 Bsal 3433 BarDI 3420 Nrul 972 PBR322 4,361 bp BstAPI 1045 Ahdi 3361 BspMI - Bfual 1063 PAMI 1315 Bsml 1353 PAMI 1364 Acul 3000 Ori Styl 1369 Aval - BsoBl 1425 PpuMI 1438 Msel 1444 Bigl 1447 Ppu 1480 AlwNI 2884 Bell 2777 kI 2682 rop Drdi 2575 Bsgl 1650 BspEI 1664 Pcil - Afl 2473 rBl 2404 Earl 2351 Bspol - Sapl 2350 Ndel 2295 BstAPI 2291 Bsaß 1668 Xmat 2029 Pvull 2064 BsmBI 2122 Dndl 2162 BstZ171 - Acct 2244 Bsal 2225 TthI- PI 2217 Figure 1 If your gene of interest was inserted at the Sphl restriction site of the plasmid illustrated in Figure 1, describe the screening process to select the positive recombinants.Based on the image below, select the correct statement. Complex II QH₂ Q- 10 2 HO 2 HO Fe-S (2.8 FADH₂ FAD- Succinate Fumarate https://canvas.uts.edu.au/assessment questions/356986/files/1562694/download? 2e verifier-eUTT3hYal2YYTWlywV8TIFA3USmzCsM52jECmvTo O Succinate is reduced to fumarate O Succinate is oxidised to FAD O The Fe-S center shuffles electrons from FAD to ubiquinone (Q) O The Fe-S center shuffles electrons from FADH2 to ubiquinone (Q) The Fe-S center shuffles electrons from FADH2 to ubiquinonol (QH2) W 88 16°CWhat is the apc payment for cpt code 78740?
- What is the possible role for GLP-1 in bariatric surgery?Download BLOSUM30 and BLOSUMB0 substitu- tion matrices and place them side by side on your computer screen. What are the differences between the two matrices? Why do you see these differences?22:23 1O 000 · 11:24 A9 OB1 r ll l 52% . +964 782 734 3923 2m541139927815107... Patient Encounter Part 3 The pretreatment workup is summarized below. Pathology: 47-year-old female with new diagnosis of infiltrating intraductal adenocarcinoma involving the left breast and regional node. Further tests on tumor samples indicated ER (8%), PR (negative), HER2 (negative), Ki-67 (72%), and grade (poorly differentiated). Intrinsic subtype (luminal B, HER2-negative). Radiology: FDG-PET/CT indicated a 5.3 x 2.5 cm mass in the left breast which appeared to extend to the epidermis of the skin; one node in the left axilla was also involved with tumor. No other evidence of distant disease was visualized. Laboratory: CBC, liver, and kidney function tests WNL, alkaline phosphatase and calcium are normal also. Stage: IB (T, N, M,) List the most important prognostic factors in this patient with newly diagnosed breast cancer. Assess the patient's level of risk for relapse. 50 SECTION 16 | ONCOLOGIC…
- hi, can I please get help on a case study on nueroanatomy I have been struggling for a couple of hours now and can't seem to understand the study to answer the following questions. is there any way or format that i can get help. I would really appreciate it. thanks! 1. Based on the information in the case, what is the most likely neuroanatomic location for a single lesion that can explain all of the patient’s symptoms and signs? In your own words, explain how you arrived at that localization. 2.What are some possibilities for the nature of the lesion (e.g., stroke, tumor, trauma, etc.)? In your own words, explain your rationale for these options. 3. How does the laboratory data and neuroimaging demonstrate the actual lesion for the patient? Describe how you interpret the data in your own words. 4.How was the patient was treated, and how did they subsequently fare? Describe the treatment plan in your own words.Pharmacodynamic (PD) Response Biomarkers Instructions Group (https://www.ncbi.nlm.nih.gov/books/NBK326791/), a biomarker is used to show that a biological response has occurred in an individual who has been exposed to a medical product or an environmental agent. Match the pharmacodynamic/response biomarker on the left, with the related you can use internet search, FDA According to the FDA-NIH Biomarker Working treatment/disease on the right. Please note that and NIH websites, as well as the on-line library resources. Sweat chloride Response to warfarin treatment International Effect of enzyme replacement therapy for patients with mucopolysaccharidosis type 1 normalized ratio (INR) Response to a B-lymphocyte stimulator inhibitor in patients with systemic lupus erythematosus Viral load Urinary level of glycosaminoglycans Response to cystic fibrosis transmembrane regulator (CFTR) potentiating agents in patients with cystic fibrosis Blood pressure Response to antihyperglycemic agents or…Below is a primary sequence alignment between the wild-type hemoglobin protein, and the hemoglobin mutant that causes sickle-cell anemia. Please look at the alignment and select the correct answer below. wt_hemoglobin: MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK 60 sickle_cell: MVHLTPVEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK 60 ****** ***************************************************** wt_hemoglobin: VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG 120 sickle_cell: VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG 120 ************************************************************ wt_hemoglobin: KEFTPPVQAAYQKVVAGVANALAHKYH 147 sickle_cell: KEFTPPVQAAYQKVVAGVANALAHKYH 147 Answers: A) The observed mutation is a negatively charged to a nonpolar amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold B) The observed mutation is a negatively charged to a polar amino acid. Such a change…
- explain this result in a brief and clear way, Here is the link where the image came from: https://mdpi-res.com/d_attachment/ijms/ijms-21-05129/article_deploy/ijms-21-05129.pdf?version=1595262192What does the acronym TPA stand for and how is TPA used in diagnostic medicine? Explain 2-3 sentencesquestion: Can you summarize and explain for me what you want to tell in the article below? When I read it myself, I do not understand exactly what is meant by the article. It would be nice if you could highlight the important points. You can use them in a figure or diagram to explain. thank you and hava a nice day :) Article: Photodynamic Inactivation of SARS-CoV-2 In addition to drug- and vaccine-based antiviral strategies, photodynamic therapy (PDT) stands as a unique approach to inactivate SARS-CoV-2. Using a light-based method, PDT attacks target cells via the excitation of photosensitive agents, called photosensitizers (PSs), with radiation characterized by a wavelength corresponding to its absorption spectrum to generate reactive oxygen species (ROS) in the presence of oxygen, which ultimately results in cell death. Photodynamic therapy is primarily used for the clinical treatment of various oncological disorders. It was not until the 1970s that PDT was first used clinically…