Give the ABBREVIATED NAME of the nucleotide in the 5' end." OCH
Q: Translate the following mRNA nucleotide sequence into an amino acid sequence, starting at the first…
A: The deoxyribonucleic acid (DNA) is the hereditary material that transmits the genetic information…
Q: Write the sequence of the complementary DNA strand that pairs with each of the following DNA base…
A: The deoxyribonucleic acid (DNA) is a molecule composed of two polynucleotide chains. It coils around…
Q: For the top three nucleotides, number all the carbons in the sugars, circle the nitrogenous bases,…
A: A polynucleotide is a molecule made up of nucleotide monomers that are joined together by covalent…
Q: 5' AU Py U A AGGCC G. UGGC G C G GGG What modified nucleoside base is indicated by the arrow?…
A: The answer of the above question is : Pseudouracil (Ψ). Pseudouridine (psi- Ψ)is an isomer of the…
Q: Cystic Fibrosis is caused by which of the following? a. Replacement of three nucleotides with a new…
A: Answer is Option c(Deletion of three nucleotides) and explaination is given in the following steps:…
Q: Identify the nucleotide. CH HN 9. N' O. 0-P-OCH2 O DUMP O dGMP O DAMP O dCMP O dTMP
A: Given below is a structure of nucleotide as it contains a base, sugar & phosphate group. The…
Q: If you are given the DNA sequence: T-A-C-G-G-T-C-A, determine the complimentary DNA strand.
A: DNA is the molecule which stores the genetic information in an organism that makes the nucleotide,…
Q: Identify the following nucleotide: ball & stick v labels Name:
A: Bothribonucleic acid (RNA) and deoxyribonucleic acid (DNA) are composed of nucleotides. A nucleotide…
Q: How does a dideoxynucleotide differ from a deoxynucleotide?
A: dideoxynucleotide is any nucleotide formed from a deoxynucleotide by loss of a second hydroxy group…
Q: Which strand was used to form the following amino acid. strand 3 "ATGGAATGTTTACCCGTATTATACGGATAGACG…
A: The four bases of DNA—the A, C, G, and Ts—are strung together in such a way that the cellular…
Q: What is Exons C
A: Exons are nucleotide sequences in DNA and RNA that are conserved in the creation of mature RNA.…
Q: One DNA strand has the sequence 5' -ATTCCGTAGC-3' what is the complementary strand sequence?
A: DNA ( Deoxyribonucleic acid ) is two stranded structure which act as genetic material in most of the…
Q: Translate the following mRNA nucleotide sequence into an amino acid sequence, starting at the second…
A: The mRNA (messenger ribonucleic acid) is synthesized from a DNA (deoxyribonucleic acid) template.…
Q: If a bacterial protein is 3,300 amino acids long, how many nucleotidepairs long is the gene sequence…
A: Introduction Genome consists of DNA/RNA which consists of nucleotides either deoxyribose…
Q: Which form of flavin adenine dinucleotide is the "reduced" form, FAD or FADH2? Explain
A: Flavin Adenine Dinucleotide: It is a redox active coenzyme associated with various proteins, which…
Q: Using the complementary base pairing rules in DNA, complete the following base pairs: 3D Adenine -i…
A: According to the complementary base pairing rule in DNA- Adenine and Thymine are complementary to…
Q: If the DNA gene is TAC GGT TTA CAG, which amino acids will be put together?
A:
Q: Write the complementary sequence of DNA AGCTAT AGC
A: A DNA is a double stranded structure. Both the strands are complementary to each other. Adenine (A)…
Q: Using paper cutouts of the nucleotides, Watson compared the ___ of the base pairs. A. hydrogen…
A: Watson and Crick give the double-helical structure of DNA. Two ribbon-like structure depicts the…
Q: If the anticodon of a molecule of tRNA has the sequence GAU, what was the original DNA sequence?
A: Question - If the anticodon of a molecule of tRNA has the sequence GAU, what was the original DNA…
Q: Draw and label the following RNA tetranucleotide: 5’phosphoryl-A-2’O-methyl-C-U-G-3’-phosphate
A: DNA (deoxyribonucleic acid) and RNA (ribonucleic acid) are polynucleotides, i.e., they are polymers…
Q: In the sequence 5'-TCCGGA-3, an available phosphate group would be found at the 5' end of the…
A: Introduction: A nucleotide is an organic molecule that consists of a nitrogenous base, pentose…
Q: If this sequence of bases was on one side of a DNA moléčulé, whát wõuld be on the opposite side?…
A: The answer is TTTAGCC. The last option.
Q: Adenine is a niterogenous base or nucleosides?
A: Adenine is a important component of nucleic acids . It is a type of purine. It contains 5 nitrogen…
Q: Write the sequence of reverse compliment chain to this DNA sequence: CGTCCGCCCCGCGAGCACA…
A: Double stranded nucleic acids are formed through hydrogen bonding between complementary nitrogenous…
Q: In a double-stranded, B-form DNA, how many nucleotide bases can be found in 3 turns of the double…
A: Watson and Crick first described the structure of the DNA double helix in 1953 using X-ray…
Q: Give the sequence of unpaired bases that would be sticky with the following sequences:(a) GGTAC (b)…
A: Restriction endonucleases may cut DNA. The ends of the DNA may be blunt or sticky. A straight cut…
Q: Write the complementary strand to the following single-stranded DNA and label the 5' and 3' ends:…
A: DNA is the molecule found inside cells that carries the genetic data required for an organism's…
Q: 5'G-A-T-A-C-А-А-с-А-т-G-G-A-с-A-T-G-A-с-т3' What would be the first 3 bases in the 5' end of the…
A: In DNA four types of nitrogenous bases are found in which adenine (A) is complementary with the…
Q: Draw the structure of the nucleotide represented by dTMP.
A: Nucleotides are organic molecules which is composed of a sugar moiety, a nitrogenous base, and a…
Q: B D A E 1. The RNA primer is denoted by letter 2. The leading strand is denoted by letter 3. The…
A: The DNA replication involves synthesis of new DNA from the old DNA by semiconservative mode. The DNA…
Q: Write the base sequence that would be sticky with the sequence T-A-T-G-A-C-T.
A: Erwin Chargaff discovered the complementary base pair rule. according to the chargeoff base-pairing…
Q: Type the matching bases below in each DNA sequences. A T T C G A C G T C
A: DNA sequence composed of a row of chemical building blocks - called "bases". There are four types of…
Q: what is the n-terminal AA residue? use one-letter code for amino acid
A: The N-terminal amino acid residue is the amino acid that is present in the N-terminal. For protein…
Q: Using the codon chart, if the DNA strand being described is AGG TCT GAT , the resulting amino acid…
A: The order in which amino acids are found in a protein. Proteins are made up of 20 different types of…
Q: Name the bases in the pentanucleotide with the sequence G-A-U-C-A. Does this come from RNA or DNA?…
A: The nucleic acids Deoxyribose sugar (DNA) and Ribose sugar (RNA) are nucleotides that are made up of…
Q: In a single strand of DNA, is it ever possible for the number of adenines to be greater than the…
A: In a DNA molecule purine always pairs with a pyrimidine base. Adenine is a purine base and thymine…
Q: What is the term applied to the trinucleotide shown by the arrow? 5' AU Ру AGGCC G C G G G ACCACCUGe…
A: This a structure of tRNA, The tRNA molecule has a distinctive folded structure with three hairpin…
Q: What kind of repeating polynucleotide would yield a single polypeptide with a tetrapeptide repeating…
A: Polynucleotide is a sequence of nucleotides. Nucleotides consist of a sugar molecule, a phosphate…
Q: For each of the proteins involved in DNA replication in E.coli that is shown, select the best…
A: Given, Primase Adds/subtracts supercoils and can remove the knots or loops in DNA DNA…
Q: A DNA sample contains 21% adenine. What is the complete percentage base composition?
A: Given Values: dsDNA has A = 21%
Q: From the above sequence (DNA: ATGGATCCGCTTTAG), what is the amino acid sequence?
A: - Cells decrypt mRNAs by reading their nucleotides in teams of 3, known as codons. Here square…
Q: What is the complementary sequence of the given nucleic acid sequence? (write your answer in the…
A: Introduction : The rules of base pairing (or nucleotide pairing) in DNA are: A with T: the purine…
Q: Draw and label the following RNA tetranucleotide: 5'phosphoryl-A-2'O-methyl-C-U-G-3'- phosphate.
A: A tetranucleotide is sequence of four base pairs in RNA (ribose nucleic acid) is known as RNA…
Q: If the length of E.coli DNA is 1.36 mm, calculate the number of base pairs it contains
A: Introduction: DNA (deoxyribonucleic acid) is the molecule that transmits genetic information for an…
Q: Give the name of the base, the ribonucleoside or deoxyribonucleoside, and the ribonucleoside…
A: The RNA and DNA are the nucleic acids present in the cells . Both RNA and DNA consists of…
Q: If the template strand of a DNA is 3’-ATCATG-5’, what will be the complementary strand?
A: A nucleotide is a bio molecule that consist of a nitrogenous base, a pentose sugar (deoxyribose in…
Q: Give the sequence of the complementary DNA strand of the DNA chain with the following base sequence:…
A: Deoxy ribonucleic acid is the double-stranded hereditary material that consists of sugar,…
Step by step
Solved in 3 steps
- Aa Po AaBbCcDc AaBbCcDdEe AaBbCcDdE AaBbCcDdE AaBbCcDdE BIUVab x, x A ev A 三==|這、|の Caption Emphasis Heading 1 Heading 3 Heading 4 Style Pane (a) Complete the table, using a letter D, R or B, to show whether each statement applies to: Fo DNA only (D) TA2G – Completed forms must be available for Open Awards external moderation purposes. Page 6 of 15 > T | RNA only (R) Both DNA and RNA (B) Statement D or R or B Contains thymine Contains ribose Consists of two chains connected to each other with hydrogen bonds Has a sugar-phosphate backbone Has four different nitrogenous bases Contains a pentose sugar Is found in the nucleus and cytoplasm English (United Kingdom) Focus 目民 2490 words +1a) what si the nucleotide at the 5 prime end of the picture? b) what si the DNA sequence from 5 prime to 3 prime pls help, urgently required, no explanation neededStructure and Nomenclature Name the second complementary base from the 5' direction. USE ALL CAPITAL LETTERS ONLY. Name the second complementary base from the 3' direction. USE ALL CAPITAL LETTERS ONLY. NH, NH2 O OH 0=P- NH NH: NH, NH: OH OH O-P-o- OH OH 0=P-O- OH OH 1:44 pm O Type here to search G 4) ENG 11/10/2021 14
- ture.com/courses/7611/assignments/170598?module_itemid%3D695428 TR E Edulastic: Formativ. A Desmos | Testing O YouTube I Quiz | ReadTheory Quill.org - In О в, С, А, D D, B, A, C C, B, D, A How many nucleotides are represented in the diagram? * 2 points O 6 12 18Helicase is wrongIdentify the correct name or abbreviation for the given nucleoside or nucleotide. guanosine ADP dADP dGDP GDP Identify the correct name or abbreviation for the given nucleoside or nucleotide. GDP dADP ADP O deoxyadenosine dGDP OMP O || -O-P-O-P-O. fot O™ tt -O-P-O- O™ ܘ ܐ ܘ ܐ OIPIO N OH OH OH N H₂N N ΝΗ N NH₂
- A Meet - rfc-prp x A G-Unit 5: DNA an X 4 https://docs.goog x y google classroom xP Classes cs.google.com/forms/d/e/1FAlpQLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHN0OdqFX_aDbV_6-bKw/formResponse x New Tab D YouTube Маps E Copy of Distance Le. Launch Meeting - . 2020 HORNETS 4N. O StudentVUE 2 Mr. Nussbaum Lan. A Graphing Lines Use the chart to determine the correct amino acid that this DNA would code for - ATA * 1 point GFL E D А Y STOP Alanine U Tyrosine C. STOP Stop V Valine GU Cysteine U Stop G Tryplophan R Arginine G А С U A Leucine S. K Serine A C L UGA Lysine Proline Аsparagine M START H. I R o search 99. Serine ThreonineNumbering the fragments left by cutting the DNA with BAM HI from left to right, which fragment will travel the furthest? BAM HI: GGATCC CCTAGG AATCGGATCCATTTGGACTAAAGGACCCGGATTGGATCCAGGGCCTTTAGTACC TTAGCCTAGGTAAACCTGATTTCCTGGGCCTAACCTAGGTCCCGGAAATCATGG O 3 O 2 4. 1.AU Py U AGGC C UGGC G GG C Jc What modified nucleoside base is indicated by the arrow? dihydrouracil pseudouracil -ACC.
- What is the term applied to the trinucleotide shown by the arrow? 5' Py U AU AGGCC G C G ACCACCUGe61 identify the primer 3' 5' a 5' 3' C e f a 5' 3' 3' 5' Select an answer and submit. For keyboard navigation, use the up/down arrow keys to select an answer. a a b b e f a Save Unanswered6. Refer to the figure answer the following questions. Alignment Hide Colors View Alignment File CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR--------VDIALECERYLAPK 50 -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 --WSDIAAECERFLGPM 52 :.. GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 Human_AA Oyster AA Corn_AA GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD-----ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: *... DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG- -TPDSRLDWGPDMICSDDTOYSN--GRG 163 Human_AA Corn_AA :: * Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two II. one III. three IV. four b) What does the (*) mark mean in…