Name two (2) elements which fit each of these descriptions Found in biological macromolecules Found in biological fluids in ionic form Trace elements
Q: can you tell what the pKas are from this unknown amino acid based on buffering regions and narrow…
A: pH = If [H+] concentration in a solution is high, the pH will be low and the solution is acidic. If…
Q: Calculate either [H3O+] or [OH-] for each of the solutions at 25 °C. Solution A: [OH¯] = 1.43 × 10¯7…
A: To calculate [H3O+] and [OH-] for each of the solutions, we can use the equation for the ion product…
Q: Sickle cell anemia patients suffer from a distorted red blood cell shape and an anemic condition as…
A: d. In sickle cell anemia patients, 100% of the hemoglobin assembled contains the mutant β globin,…
Q: Phosphoglucoisomerase interconverts glucose 6-phosphate to, and from, glucose 1-phosphate.…
A: Details
Q: Classify the inhibitor characteristics according to one of three types of inhibition: reversible…
A: 1.Reversible NoncompetitiveCharacteristic: Inhibitor binds noncovalently at other than active…
Q: H₂C-C Ö: CH₂ H3C - с CH₂ + Clear The Lewis structure of acetone enolate ion, which has one other…
A: Enolate ion have 2 resonance forms. Resonance structure 1 has a negative charge on carbon and a…
Q: A tetrapeptide was analyzed with carboxypeptidase, the results from the analysis are found in the…
A: There are four classes of biological macromolecules- proteins, nucleic acids, lipoproteins and…
Q: Draw a diagram of the aspartic acid side chain in the protonated and unprotonated states. Calculate…
A: The four classes of biological macromolecules are proteins, nucleic acid, lipids and…
Q: Decide whether each of the following statements is true about ornithine carbamoyltransferase. It's a…
A: Ornithine carbamoyltransferase is an enzyme is important in the urea cycle. Urea cycle is a…
Q: Drag the terms on the left to the appropriate blanks on the right to complete the sentences. Terms…
A: Nucleotide metabolism is the set of biochemical reactions that involve the synthesis and breakdown…
Q: Which of the above curves corresponds to myoglobin in a solution containing physiological…
A: The given curve is an oxygen dissociation curve. The curve depicts the relationship between the…
Q: Which of these statements about hemoglobin is NOT true? A) it is a tetrameric globular protein b)…
A: Hemoglobin is the protein in red blood cells that carries oxygen to the organs and tissues of the…
Q: The hydrolysis of pyrophosphate to orthophosphate drives biosynthetic reactions such as DNA…
A: The Vmax of the enzyme is given as 2800 U per milligram of enzyme . To convert this value to…
Q: In the peptide shown below, a covalent bond that could rotate to form secondary structure is…
A: There are two types of secondary structures are which are found in protein: alpha helix and beta…
Q: Choose any/all that apply to protein synthesis. Ribosomes aid in the formation of peptide bonds…
A: As per the central dogma of molecular biology, genetic information for protein synthesis is stored…
Q: Name the two most common atoms hydrogen bonds within biological systems that give hydrogen a partial…
A: Hydrogen bond is formed between a hydrogen atom which is bonded to an electro negative atom( donor)…
Q: Draw a diagram of the hydrogen bonding interactions in: i) a two-stranded antiparallel beta sheet,…
A: Secondary structure of protein: Formed due to twisting of polypeptide chain.The folding is due to…
Q: Using a flowchart, illustrate and differentiate the flow of the electrons in the ETC when electrons…
A: NADH produced through glycolysis is present in the cytosol of the cell. The glycolytic pathway is…
Q: The reagent dithiothreitol (DTT) is commonly used to reduce disulfide bonds in Proteins. The…
A: DTT works as a reducing agent by donating electrons to break disulfide bonds in proteins, leading to…
Q: A protein which has more than one stable conformation is called a: a) chaperone protein b) molten…
A: There are three classes of biological macromolecules: proteins, nucleic acids, lipids and…
Q: The pH is O High; Low Low; High in the lungs and in the muscles. O High in the lungs but there is no…
A: A substance's pH indicates how acidic or alkaline it is. "H" stands for hydrogen, and the pH scale…
Q: 1. We tested a hypothetical Unknown #3. Does our result below mean the compound is present or absent…
A: In order to find whether or not a particular biomolecule is present in an unknown sample, we…
Q: Please draw the structure of the 19 L-a-amino acids and proline in any form, as you prefer. You may…
A: Amino acids serve as monomers of proteins and composed of a carboxyl group, an amino group, a…
Q: = An Fab fragment binds to lysozyme with a dissociation constant of Ka 10-11 M. A 1 nM (10-9 M)…
A: We are given the binding kinetics between lysozyme (receptor) and Fab fragment (ligand).
Q: Recall from the central dogma that DNA codes for mRNA, which then codes for protein. Also recall…
A: As per the central dogma of molecular biology, the genetic information for protein synthesis is…
Q: Phosphofructokinase catalyzes the conversion of ... O A) oxaloacetate to citrate B) glucose to…
A: The process of breaking down glucose to generate energy is known as glycolysis. It produces two…
Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…
A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…
Q: Many biochemists go bananas, and justifiably, when they see a Michaelis-Menten plot like the one…
A: For a one-substrate enzyme catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: Consider a protein in which a negatively charged glutamic acid side chain (pKa=4.2) makes a salt…
A: Salt bridges are attractive interactions between two oppositely charged groups. So, more oppositely…
Q: 4. For the figure below, label the 5' and 3' ends for each strand, the hydrogen bonds, and the…
A: DNA is the genetic material present in every cell of living organisms.DNA is made of two…
Q: Some reaction components are shown on the left. Match them to the reactions catalyzed by glutamine…
A: Glutamine is a polar, uncharged amino acid. Glutamate is a negatively charged, acidic amino…
Q: Modify isoleucine to show the predominant forms at pH 1, 7, and 13. Isoleucine has p?ap�a values of…
A: Isoleucine is non-polar aliphatic amino acid. Amino acids are biomolecules that have an amino group…
Q: (a) Using the lecture entitled “On the Origin of life” by Jack Szostak. In one paragraph, summarize…
A: In his lecture titled "On the Origin of Life," Jack Szostak delves into the concept of an "RNA…
Q: Identify weak noncovalent interactions of biomolecules in aqueous systems including hydrogen…
A: Understanding the complex weak noncovalent interactions of biomolecules in aqueous systems is…
Q: After a polypeptide chain has been synthesized, certain amino acids in the peptide may become…
A: The modified amino acid shown in the structure you provided is serine (Ser).The modification that…
Q: For the equilibrium below, pKa₁ = 7.9 and pKa2 = 10.1. At what pH is [HA] equal to [A²-]?
A: pH of any acid or base tells us its hydrogen ion concentration.PKa- it is that pH when the 50%…
Q: 1Need help:. draw valine-aminoacyl tRNA synthetase. Show the tRNAs and the valine amino acid. You…
A: A transfer RNA (tRNA) is a unique type of RNA molecule with the essential function of facilitating…
Q: Where is the active site for this enzyme located?
A: Active site of an enzyme is the part of the enzyme where substrate molecules bind and undergo a…
Q: Why would your protein measurement not match to package label? Let us disregard the idea that the…
A: One plausible explanation for a discrepancy between the measured protein content of a product and…
Q: 1. (a) By binding one L-tryptophan molecule/monomer, the trp repressor binds to DNA to sup- press…
A: An atom's or molecule's electrostatic charge, which can be either positive or negative depending on…
Q: Some of the first vaccines against COVID-19 are based on RNA molecules that code for the production…
A: An mRNA vaccine is a type of vaccine that uses a copy of RNA (mRNA) to produce an immune response.…
Q: All amino acids have two ionizable functional groups: an a-amino group (average pK₁ of 9.4) and an…
A: Amino acids are biomolecules that have an amino group and a carboxyl group linked to the same carbon…
Q: Draw the haworth projection of starch (only 2 connected monomers) and cellulose (only 2 connected…
A: Chemically carbohydrates are polyhydroxy aldehydes or ketones. They have the general formula:…
Q: Put these three molecules in the order of most oxidized to least oxidized. нн нс-с-н нн H > > 0=…
A: In chemistry, the concept of oxidation state plays a crucial role in assessing the degree of…
Q: Given the data for Chymosin shown below: What are the catalytic constants (i.e. Km and Vmax) for…
A: Km is the catalytic constant which is equal to substrate concentration at half of maximal…
Q: Gamma turns are divided into two classes based on the phi and psi rotational bond angles of the…
A: An illustration of the permitted and forbidden areas of the phi and psi dihedral angles in the…
Q: EP 1: Enzyme(E)+Substrate(S)=Enzyme-Substrate Complex (ES) FAST EP 2: Enzyme-Substrate Complex(ES)…
A: Enzyme catalyzed reaction occurs rapidly because it decreases activation energy hence causes the…
Q: Identify the kind of chemical catalysis and then identify which of the given amino acids can act as…
A: Enzymes catalyze reactions using various types of mechanisms. Some of the most observed mechanisms…
Q: Which plot shows the relationship between reaction rate and substrate concentration? O O Reaction…
A: Enzymes are biological catalysts that increase the rate of biochemical reactions.Most enzymes are…
Q: Classify the following descriptions of enzyme inhibition as either reversible inhibition or…
A: Enzymes are high molecular weight proteins that catalyse biochemical reactions. They contain an…
- Name two (2) elements which fit each of these descriptions
- Found in biological macromolecules
- Found in biological fluids in ionic form
Trace elements
Step by step
Solved in 3 steps
- Give the Physiological importance of Group III cationsA strain of bacteria isolated from an alkaline lake with a high concentrationof arsenic is able to incorporate As into biological molecules. What class of molecules is most likely to contain As as part of its structure?Discuss whether the following statement is correct: “An ionic bond can, in principle, be thought of as a very polar covalent bond. Polar covalent bonds, then, fall somewhere between ionic bonds at one end of the spectrum and nonpolar covalent bonds at the other end.”
- Many proteins that remain homogeneously distributed in water have molecular masses in the range of 30,000 amu and larger. In what sense is it appropriate to consider such suspensions to be colloids rather than solutions? Explain.(b) Explain each of the following in terms of the properties of water. You are not limited to the three properties discussed in part (a): •the role of water as a medium for the metabolic processes of cells the ability of water to moderate temperature within living organisms and in organisms' environment • the movement of water from the roots to the leaves of plants B IUX² x, 3 ¢ 0/1 IISolid iron(II) fluoride (FeF2, Ksp= 2.36 x 10-6) is dissolved in water. If 8.1 x 10-3 mol L-1 of iron(II) ion is found to be in solution. Is the solution saturated, unsaturated, desaturated or supersaturated.
- Explain the fluidity of liquids in relevance to the postulates of the kinetic molecular theory.The following are basic building blocks of macromolecules match the building blocks with the statements below.Hydrogen bonds and van der Waals interactions are much weaker than covalent bonds, yet they are vital to organisms. Explain, providing some specific examples.
- Why doesn't frozen water sink in liquid water? Is the liquid phase of water more or less dense than the solid phase? What accounts for this pattern? Is this an unusual pattern (by comparison to other molecules)? Explain. Be specific.Which of these statements about the tertiary structure of a polypeptide is(are) untrue? You may select more than one answer. The tertiary structure will be maintained when the solvent is changed from pure water to aqueous acetic acid. O The tertiary structure is determined in part by the formation of disulfide bridges. Hydrogen bonding interactions are responsible for formation of secondary structure but not tertiary structure, O The tertiary structure is rigid and unchanging. O Charge-charge (electrostatic) interactions can be important in the tertiary structure.Based on the ternary phase diagram, a binary mixture of furfural and water will always split into two liquid phases: 1) 95 % furfural, 5 % H20 and 2) 92 % H20. 8 % furfural. Etylene Gyesl Single phase region Two phase region 03 02 M Furfural Water Mass fraction furtfural FURFURAL-WATER MIXTURE Neither true nor false The actual composition depends on other experimental parameters. False O True Mass fraction O O O