Brainbow is a genetic approach to fate mapping developed to label cells with a seeming rainbow of possible colors, which can be used to identify each individual cell in a tissue or even a whole embryo. Give the mechanics behind this technique. What are its applications to the field of Biology in general, and to Developmental Biology in particular?
Q: The following choices are various developmental phenomena relating to the concepts and principles in…
A: There is a separate branch of biology that deals with the process related to growth and development.…
Q: When an embryo is homozygous mutant for the gap gene Kr, the fourth and fifth stripes of the…
A: Segmentation in the Drosophila embryo is regulated by pair-rule genes and gap genes.
Q: The following are various developmental phenomena relating to the concepts and principles in…
A: Introduction: Developmental biology and molecular biology give insights into the evolutionary…
Q: The following are various developmental phenomena relating to the concepts and principles in…
A: Developmental biology is a branch if biology that defines about the growth of the multicellular…
Q: a. What is the Raly gene? What does it encode? How does it relate to the lethality of Ay? b. A…
A: "Genes" are the fundamental unit of heredity. They store genetic information in the form of DNA,…
Q: aternal effect gene in Drosophila, called torso, is found as a recessive allele that prevents the…
A:
Q: A Drosophila embryo dies during early embryogenesis due to arecessive allele of a maternal effect…
A: Phenotypes and genotypes represents the traits that gets passed on from the parents to the progeny.…
Q: What slide preparation technique should you use for the following research goals? Briefly justify…
A: Microscope is an optical instrument which has major application in visualizing very small to…
Q: The following are various developmental phenomena relating to the concepts and principles in…
A: Developmental biology is the branch of biology which deals with development and growth of organisms.…
Q: Which of the following is true regarding Lyonization? Question options: Involves the…
A: Chromosomes are observed in the cell's nucleus and contain the genetic material of the cell. In…
Q: “In an organism that reproduces asexually, there is no difference between a somatic cell mutation…
A: Somatic mutations These refers to the mutations in a single body cell, which cannot be inherited.…
Q: In all mammals, insulin growth factor 2 is expressed from only the allele that is inherited by one's…
A: Igf2 stands for insulin growth factor 2. It is responsible for maintaining the growth in the tissue…
Q: Discuss the concepts of: 1. Cell diferentiation 2. Morphogenesis 3. Pattern formation Also, cite…
A: The above processes are very important in development of the organism and for its normal…
Q: Which of the following molecular events is NOT involved in Drosophila ventralization? a. Easter…
A: NOTE: since you have posted multiple questions so we will be solving the first three for you. As per…
Q: Fragile X syndrome What are the symptoms or characteristics of this disorder or trait? What is…
A: Fragile X syndrome Fragile X syndrome (FXS) is a disorder which causes mainly mental and…
Q: In most animals, a larger amount of cytoplasm is carried by the egg then by sperm. Similarly, the…
A: Nuclear genes are the genes or the genetic information present in the chromosomes which are usually…
Q: An ancestral gene "Stacin" is involved in initiating parental care in both males and females. The…
A: ANSWER;- Subfunctionalization
Q: The following system models the exchange of nutrients between mother and fetus in the placenta:…
A: The mechanism below simulates the flow of nutrients between the mother and the fetus in the womb.…
Q: A hypothetical cell lineage is shown here. A gene, which we will call gene X, is activated in the…
A: The term heterochronic indicates the cellular and tissue level development that takes place at an…
Q: The gene controlling Abo blood type and the gene under lying nail patella syndrome are said to show…
A: The genetic linkage is a condition in which two or more genes tend to inherit together and do not…
Q: molecular genetics, epigenetics and development biology principles, elucidate how the over 200…
A: The branch of genetics that deals with the molecular level study of gene function and structure is…
Q: What is positional information? Discuss three different ways that cells obtain positional…
A: Drosophila is a commonly used model organism for studying developmental biology and genetics. The…
Q: polydactyly is an abnormality characterized by webbing between partially or completely duplicated…
A: Given: Need to explain the abnormality characterized by webbing between partially or completely…
Q: most animals, a larger amount of cytoplasm is carried by the egg than by the sperm. Similar carries…
A: More cytoplasm is contributed by female parent then male. Some organelles like mitochondria and…
Q: The following choices are various developmental phenomena relating to the concepts and principles in…
A: The biological species thought explains why the members of a species correspond each other, i.e.…
Q: Using breeding techniques, Andrei Dyban and V. S. Baranov (Cytogenetics of Mammalian Embryonic…
A: Trisomy is the condition of the presence of three copies of one or more chromosomes in the genome.…
Q: Which of the following is the definition of the term named Genes? a.Refers to genes that have…
A: Heredity is the process of transmission of genetic variations from the parents to the offsprings.…
Q: Please help True or false, if false rewrite the statement in a way that makes it true. a) A cell…
A: A cell can be defined as the basic structural, functional, and biological unit of all known living…
Q: What complications might arise from genetic screens targeting an organ that differentiates late in…
A: The eye has been one of the most intensively studied organs in Drosophila. The wealth of knowledge…
Q: To understand the genetic basis of locomotion in the diploid nematode Caenorhabditis elegans,…
A: Introduction Genetics is a branch of biology that studies genes, genetic diversity, and heredity in…
Q: Removing the patch of tissue called the ZPA from one limb bud and placing into onto another…
A: ZPA is a zone of polarising activity, gives molecular signaling during limb formation in…
Q: three children. What is the probability that one their children will be normal (unaffected) and two…
A: Autosomal recessive mutation leads to autosomal recessive disorder. This will occur when you…
Q: Which of these are cellular activities that sustain a single-celled organism through its lifetime?…
A: The one cell of a unicellular organism must be able to perform all the functions necessary for life.…
Q: Select the true statements. (can be multiple). Sperm and egg cells are diploid, meaning that…
A: Haploid cells contain a single set of chromosomes. Diploid cells contain two sets of chromosomes.
Q: Complete the table below to describe the phenotypic consequences for a loss-of-function allele and…
A: During the development of cancer two genes are contributed that are; proto-oncogene and…
Q: How does a single fertilized egg (zygote) give rise to the variety of cell types, organs, and…
A: Zygote is formed via the fertilization of male and female gamete .
Q: A maternal effect gene in Drosophila, called torso, is found as a recessive allele that prevents the…
A: Introduction The relationship between two variants of a gene is referred to as dominant. Each parent…
Q: Using Figure 22.6, indicate the stage at which segmentation genes, homeotic genes, and egg-polarity…
A: The fruit fly has several genes which regulate the development of different structure at different…
Q: The following choices are various developmental phenomena relating to the concepts and principles in…
A: Developmental biology is the field that deals with how animals and plants develop from a single cell…
Q: Four homozygous recessive mutant lines of Drosophilamelanogaster (labeled 1 through 4) showed…
A: Introduction Heterozygous means that you have inherited various versions of a gene from each parent.…
Q: The following choices are various developmental phenomena relating to the concepts and principles in…
A: Introduction: Developmental biology and molecular biology give insights into the evolutionary…
Q: What are some master genes important in embryonic development? Discuss.
A: INTRODUCTION HOX gene HOX genes are the master gene involved in embryonic development in animals.…
Q: A. Concept of apoptosis
A: The study of the development of various organisms is called developmental biology. It starts from…
Q: Our understanding of maternal effect genes has been greatly aided by their identification in…
A: A maternal effect is a phenomenon where the nuclear genotype of a mother is expressed in the…
Q: Match the following terms with their correct definitions. A change in a gene that causes it to…
A: Activating mutations in proto-oncogenes that cause growth. Protooncogenes are the genes which causes…
Q: What is meant by the term cell fate? What is a cell lineage diagram? Discuss the experimental…
A: A cell is the fundamental unit of life. All living organisms are made up of one or many cells. Each…
Q: The following are various developmental phenomena relating to the concepts and principles in…
A: Developmental biology It is defined as the field of biology that studies the processes through which…
Q: Question #1. Death of some lymphocytes. What concept? Question #2. There are two sets of organizing…
A: Developmental biology is a field of studying the forms and functions of an organism. There are…
Q: There is a gene in the fruit fly (Drosophila) called antennepedia. It controls the formation of…
A: Drosophila melanogaster or common fruit fly or vinegar fly is one of the species of fly. They belong…
Q: Which of the following are included in the chimera protocol for determining how genes are regulated…
A: Chimera -- Manipulation of genes with in the genome has proven an effective method for learning…
Brainbow is a genetic approach to fate mapping developed to label cells with a seeming rainbow of possible colors, which can be used to identify each individual cell in a tissue or even a whole embryo.
Give the mechanics behind this technique. |
What are its applications to the field of Biology in general, and to Developmental Biology in particular? |
Step by step
Solved in 3 steps
- For the first experiment ever on Drosophila mutations. Answer the following questions. a. What is the title of the first published paper explained the experiment and what is the name of the Author? b. What is the first mutation discovered in Drosophila? c. Explain the changes in the Drosophila yellow mutant (Y)compared to wild type.Another way to study the role of proteins (e.g., transcription factors) that function in development is to microinject the mRNA that encodes a protein, or the purified protein itself, into an oocyte or embryo, and then determine how this affects the subsequent development of the embryo, larva, and adult. For example, if Bicoid protein is injected into the posterior region of an oocyte, the resulting embryo will develop into a larva that has anterior structures at both ends. Based on your understanding of the function of each developmental gene, what would be the predicted phenotype if the following proteins or mRNAs were injected into normal oocytes? A. Nanos mRNA injected into the anterior end of an oocyte B. Antp protein injected into the posterior end of an embryo C. Toll mRNA injected into the dorsal side of an early embryoWhat genetic model of an organism is the most ideal? And why is it an ideal model in genetics?
- a) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSPTo understand the genetic basis of locomotion in the diploid nematode Caenorhabditis elegans, recessive mutations were obtained, all making the worm “wiggle” ineffectually instead of moving with its usual smooth gliding motion. These mutations presumably affect the nervous or muscle systems. Twelve homozygous mutants were intercrossed, and the F1 hybrids were examined to see if they wiggled. The results were as follows, where a plus sign means that the F1 hybrid was wild type (gliding) and “w” means that the hybrid wiggled.a. Explain what this experiment was designed to test. b. Use this reasoning to assign genotypes to all 12 mutants. c. Explain why the phenotype of the F1 hybrids between mutants 1 and 2 differed from that of the hybrids between mutants 1 and 5Give typing answer with explanation and conclusion If you want to identify genes linked to autism in a mouse model, which genetic approach or approaches could you use? (Mark all that apply) A) Reverse Genetics B) Forward Genetics C) Optogenetics D) Population Genetics
- Describe the main technique for amplifying a segment of DNA (like the one you suspect is involved in Lee’s cancer) from a complex mixture of genomic DNA. Remember that the entire human genome sequence is known. (Hint: This is a technique that is commonly used by laboratories that do genetic testing and various other applications of molecular biology.)What is the role played by biophysical properties in mechanisms of morphogenesis?A paper hypothesizes that white flowers are unable to produce anthocyanins (purple pigments) because they lack a functional “A” protein. However, it is also possible that an unknown gene is responsible for the lack of anthocyanins. Now that they have isolated DNA sequences of the “A” allele, design an experiment to use these DNA sequences to distinguish between these two hypotheses.
- If you wanted to make a mouse model for any of the following human genetic conditions (a–d), indicate which of thefollowing types of mice (i–vi) would be useful to your studies. If more than one answer applies, state which type ofmouse would most successfully mimic the human disease:(i) transgenic mouse overexpressing a normal mouse protein; (ii) transgenic mouse expressing normal amounts of amutant human protein; (iii) transgenic mouse expressing adominant negative form of a protein; (iv) a knockout mouse;(v) a conditional knockout mouse; and (vi) a knockin mousein which the normal allele is replaced with a mutant allelethat is at least partially functional. In all cases, the transgeneor the gene that is knocked out or knocked in is a form of thegene responsible for the disease in question.a. Marfan syndrome (a dominant disease caused byhaploinsufficiency for the FBN1 gene);b. A dominantly inherited autoinflammatory diseasecaused by a hypermorphic missense mutation in thegene PLCG2;c.…When the S.cerevisiae genome was sequenced and surveyed for possible genes, only about 40% of those genes had been previously identified in forward genetic screens. This left about 60% of predcited genes with no known function, leading some to dub the genes fun (function unknown) genes. a)As an approach to understanding the function of a certain fun gene, you wish to create a loss of function allele. How would you do this? b)You wish to know the physical location of the encoded protein product. How would you obtain such information?(2) Design an experiment on how would molecular genetic tools, such as DNA microarrays, be used to study human diseases, such as skin tumor cell growth or migration? How could they be used to study melanin expression in nomal skin cells? Rubric for Class Portfolio #1: Student creates an experiment with experimental and negative control group on hoW DNA microarrays can used to address how it can be used to monitor skin tumor cell growth and/or migration, as well as melanin gene expression.