ORIGIN 1 acacttgctt ctgacacaac cgtgttcact agcaactaca caaacagaca ccatgctgac 61 tgctgaggag aaggctgccg tcaccgcctt ttggggcaag gtgaaagtgg atgaagttgg 121 tggtgaggcc ctgggcaggc tgctggttgt ctacccctgg actcagaggt tctttgagtc 181 ctttggggac ttgtccactg ctgatgctgt tatgaacaac cctaaggtga aggcccatgg 241 caagaaggtg ctagattcct ttagtaatgg catgaagcat ctcgatgacc tcaagggcac 301 ctttgctgcg ctgagtgage tgcactgtga taagctgcat gtggatcctg agaacttcaa 361 gctcctgggc aacgtgctag tggttgtgct ggctcgcaat tttggcaagg aattcacccc 421 ggtgctgcag gctgactttc agaaggtggt ggctggtgtg gccaatgccc tggcccacag 481 atatcattaa gctccctttc ctgctttcca ggaaaggttt tttcatcctc agagcccaaa 541 gattgaatat ggaaaaatta tgaagtgttt tgagcatctg gcctctgcct aataaagaca 601 tttattttca ttgcaaaaaa aaaaaaaaaa aaa Find the start codon in this sequence. What is the DNA sequence of the next codon, directly after the start codon? What amino acid does this code for? A mutation changes the start codon so that it now codes for Isoleucine (I) instead of methionine (M) What is the name given to this type of mutation? How many bases would need to change to cause this? What is the genetic term for the region of the gene before the start codon?

An Illustrated Guide To Vet Med Term
4th Edition
ISBN:9781305465763
Author:ROMICH
Publisher:ROMICH
Chapter17: Drugs And Dissection
Section: Chapter Questions
Problem 3WS
icon
Related questions
Question

Making sense of information in the NCBI database regarding a gene (you will need to look at a Genetic Code Table to help with part of this)


Gene: Haemoglobin subunit beta (HBB)

     

     Source     1…633

                     /organism="Bos taurus"

                     /mol_ type="mRNA"

     Gene          1 … 633

                     /gene="HBB"

                     /db_xref="GeneID:280813"

     CDS             53 … 490

                     /gene="HBB"

 

KLLGNVLVWVLARNFGKEFTPVLQADFQKVVAGVANALAHRYH"
ORIGIN
1 acacttgctt ctgacacaac cgtgttcact agcaactaca caaacagaca ccatgctgac
61 tgctgaggag aaggctgccg tcaccgcctt ttg88gcaag gtgaaagtgg atgaagttgg
121 tggtgaggcc ctgggcaggc tgctggttgt ctacccctgg actcagaggt tctttgagtc
181 ctttggggac ttgtccactg ctgatgctgt tatgaacaac cctaaggtga aggcccatgg
241 caagaaggtg ctagattcct ttagtaatgg catgaagcat ctcgatgacc tcaa88gcac
301 ctttgctgcg ctgagtgagc tgcactgtga taagctgcat gtggatcctg agaacttcaa
361 gctcctgggc aacgtgctag tggttgtgct ggctcgcaat tttggcaagg aattcacccc
421 ggtgctgcag gctgactttc agaaggtggt ggctggtgtg gccaatgccc tggcccacag
481 atatcattaa gctccctttc ctgctttcca ggaaaggttt tttcatcctc agagcccaaa
541 gattgaatat ggaaaaatta tgaagtgttt tgagcatctg gcctctgcct aataaagaca
601 tttattttca ttgcaaaaaa aaaaaaaaaa aaa
Find the start codon in this sequence.
What is the DNA sequence of the next codon, directly after the start codon?
What amino acid does this code for?
A mutation changes the start codon so that it now codes for Isoleucine (1) instead of methionine (M)
What is the name given to this type of mutation?
How many bases would need to change to cause this?
What is the genetic term for the region of the gene before the start codon?
Transcribed Image Text:KLLGNVLVWVLARNFGKEFTPVLQADFQKVVAGVANALAHRYH" ORIGIN 1 acacttgctt ctgacacaac cgtgttcact agcaactaca caaacagaca ccatgctgac 61 tgctgaggag aaggctgccg tcaccgcctt ttg88gcaag gtgaaagtgg atgaagttgg 121 tggtgaggcc ctgggcaggc tgctggttgt ctacccctgg actcagaggt tctttgagtc 181 ctttggggac ttgtccactg ctgatgctgt tatgaacaac cctaaggtga aggcccatgg 241 caagaaggtg ctagattcct ttagtaatgg catgaagcat ctcgatgacc tcaa88gcac 301 ctttgctgcg ctgagtgagc tgcactgtga taagctgcat gtggatcctg agaacttcaa 361 gctcctgggc aacgtgctag tggttgtgct ggctcgcaat tttggcaagg aattcacccc 421 ggtgctgcag gctgactttc agaaggtggt ggctggtgtg gccaatgccc tggcccacag 481 atatcattaa gctccctttc ctgctttcca ggaaaggttt tttcatcctc agagcccaaa 541 gattgaatat ggaaaaatta tgaagtgttt tgagcatctg gcctctgcct aataaagaca 601 tttattttca ttgcaaaaaa aaaaaaaaaa aaa Find the start codon in this sequence. What is the DNA sequence of the next codon, directly after the start codon? What amino acid does this code for? A mutation changes the start codon so that it now codes for Isoleucine (1) instead of methionine (M) What is the name given to this type of mutation? How many bases would need to change to cause this? What is the genetic term for the region of the gene before the start codon?
Expert Solution
steps

Step by step

Solved in 2 steps with 1 images

Blurred answer
Knowledge Booster
Genome annotation
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.
Similar questions
  • SEE MORE QUESTIONS
Recommended textbooks for you
An Illustrated Guide To Vet Med Term
An Illustrated Guide To Vet Med Term
Biology
ISBN:
9781305465763
Author:
ROMICH
Publisher:
Cengage
Essentials of Pharmacology for Health Professions
Essentials of Pharmacology for Health Professions
Nursing
ISBN:
9781305441620
Author:
WOODROW
Publisher:
Cengage